PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG212300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 251aa    MW: 27119.4 Da    PI: 9.4179
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG212300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.71.3e-1573127357
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          + ++++k+q +eLe++F++n+ ++++++e LA++l++t +qV vWF NrR + +k
  Pavir.3KG212300.1.p  73 QYRKLSKDQSDELEAAFQQNNFIDKRTKEALAERLKITLKQVDVWFLNRRSRLRK 127
                          67789***********************************************997 PP

2HD-ZIP_I/II65.31.4e-2174161390
          HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                           r+lsk+q+  LE  F++++ ++++ K++la++L+++ +qv+vWF nrR R +++q+E+d  + k+++++l+++++rL+++ ++L+++
  Pavir.3KG212300.1.p  74 YRKLSKDQSDELEAAFQQNNFIDKRTKEALAERLKITLKQVDVWFLNRRSRLRKQQVEEDLMQHKQQVEELTKQKNRLQRKIDKLKKR 161
                          59***********************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-1855125IPR009057Homeodomain-like
SuperFamilySSF466891.24E-1665130IPR009057Homeodomain-like
PROSITE profilePS5007116.03468128IPR001356Homeobox domain
SMARTSM003891.7E-1470132IPR001356Homeobox domain
CDDcd000863.05E-1570129No hitNo description
PfamPF000465.1E-1372127IPR001356Homeobox domain
Gene3DG3DSA:1.20.5.1703.7E-4126170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
HNDRSFLFVS LCVHYTGGGN DGSGNENDAT ELVLVDTTNH PQHAGQEDGG VLARSGVDVE  60
GDAGGGSFVR RTQYRKLSKD QSDELEAAFQ QNNFIDKRTK EALAERLKIT LKQVDVWFLN  120
RRSRLRKQQV EEDLMQHKQQ VEELTKQKNR LQRKIDKLKK RNKELKAKLK EATTQAAPPP  180
QPSPSVMLVP LPAALNTLAG LYPAGFEGNV TDMAAAAAAA LNTQQGSAAA AALPSSSAPP  240
VPPSDGRSSI *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126RRSRLRK
2120127RRSRLRKQ
3155160DKLKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963574.15e-73PREDICTED: homeobox-leucine zipper protein HOX3-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4060122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47370.13e-16Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein